Camelina sativa (false flax): 104775227 Help Entry 104775227         CDS       T05044                                  Name (RefSeq) calmodulin-like protein 12   KO K02183   calmodulin Organism csat  Camelina sativa (false flax) Pathway csat04016   MAPK signaling pathway - plant csat04070   Phosphatidylinositol signaling system csat04075   Plant hormone signal transduction csat04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:csat00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     104775227    04070 Phosphatidylinositol signaling system     104775227    04075 Plant hormone signal transduction     104775227  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     104775227  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csat01009]     104775227   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csat04131]     104775227    03036 Chromosome and associated proteins [BR:csat03036]     104775227   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csat04147]     104775227 Protein phosphatases and associated proteins [BR:csat01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104775227 Membrane trafficking [BR:csat04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104775227 Chromosome and associated proteins [BR:csat03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104775227 Exosome [BR:csat04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104775227 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg SPEF2_C Motif Other DBs NCBI-GeneID:  104775227 NCBI-ProteinID:  XP_010497730 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MRSLGHNLTKAELQGMLNEMDADGSGTIDILEFLYALIDTDCKEKLKKAIGVLSQLTEDQ LVECKEFFSSIDKDGDGFITRKELG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcgttcccttggtcacaacctgacaaaagctgagcttcaaggcatgctcaacgaaatg gatgcagatggtagcggcaccatcgatatccttgagttcttatacgcattgatcgacaca gactgtaaggaaaaactcaagaaagcgatcggagttttgagtcagctcactgaagatcag cttgtcgagtgtaaggaattcttcagctcaatagacaaggatggtgacggtttcattaca agaaaggagctcggt

DBGET integrated database retrieval system