Camelina sativa (false flax): 104778360 Help Entry 104778360         CDS       T05044                                  Name (RefSeq) ubiquitin-like protein ATG12A   KO K08336   ubiquitin-like protein ATG12 Organism csat  Camelina sativa (false flax) Pathway csat04136   Autophagy - other Brite KEGG Orthology (KO) [BR:csat00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     104778360  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csat04131]     104778360    04121 Ubiquitin system [BR:csat04121]     104778360    03029 Mitochondrial biogenesis [BR:csat03029]     104778360 Membrane trafficking [BR:csat04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     104778360 Ubiquitin system [BR:csat04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    104778360 Mitochondrial biogenesis [BR:csat03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     104778360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 DUF4264 Motif Other DBs NCBI-GeneID:  104778360 NCBI-ProteinID:  XP_010501092 LinkDB All DBs Position 3:27640333..27641695 Genome browser AA seq 92 aa AA seqDB search MATESPSSVRKVVVHLRATGGAPILKQSKFKIPGTDKFAKVIDFLRRQLHSDSLFVYVNS AFSPNPDESVIDLYNNFGIDGKLVVNYACSMA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcgacggagtcgccgagctctgttcgaaaagttgttgttcatctaagagctactgga ggtgctcctatactcaaacaatctaagttcaagattccagggactgataaatttgctaaa gtgattgactttctaagaagacaactccattctgactcattgtttgtctatgtgaatagt gcgttctcgccgaatcctgatgaatcagttattgatctttataataactttggaattgac ggcaaactggtggtaaactatgcttgttccatggcatga

DBGET integrated database retrieval system