Camelina sativa (false flax): 104780132 Help Entry 104780132         CDS       T05044                                  Name (RefSeq) SKP1-like protein 15   KO K03094   S-phase kinase-associated protein 1 Organism csat  Camelina sativa (false flax) Pathway csat03083   Polycomb repressive complex csat04120   Ubiquitin mediated proteolysis csat04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csat00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104780132    04120 Ubiquitin mediated proteolysis     104780132   09126 Chromosome    03083 Polycomb repressive complex     104780132  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csat04131]     104780132    04121 Ubiquitin system [BR:csat04121]     104780132    03036 Chromosome and associated proteins [BR:csat03036]     104780132 Membrane trafficking [BR:csat04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104780132 Ubiquitin system [BR:csat04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104780132    Cul7 complex      104780132 Chromosome and associated proteins [BR:csat03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104780132   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104780132 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ ADNP_N Motif Other DBs NCBI-GeneID:  104780132 NCBI-ProteinID:  XP_010502903 UniProt:  A0ABM0YLN5 LinkDB All DBs Position 4:complement(8991921..8992451) Genome browser AA seq 105 aa AA seqDB search MSSKKIVLTSSDGESFEVEEVVARKMQTVRQMIEDDCATNEIPLQKVTGMILAMVIEYCK RHVDDDHVATEDAKKKLKDWDEVFMKNVDADKTVSLLIAADYLKV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgaaaaagattgtgttgacaagctctgatggcgagtctttcgaagttgaggaa gtggtggcgagaaaaatgcagaccgtaaggcaaatgatcgaagacgactgtgctactaac gaaatcccgcttcaaaaagttacaggaatgatcctcgccatggttatcgagtattgcaag agacacgtcgatgatgatcatgtagcaactgaggatgcgaagaagaagctcaaggattgg gacgaagtgttcatgaagaatgttgatgctgataagaccgtcagcctccttattgctgct gactatctcaaagtgtga

DBGET integrated database retrieval system