Camelina sativa (false flax): 104780249 Help Entry 104780249         CDS       T05044                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism csat  Camelina sativa (false flax) Pathway csat04016   MAPK signaling pathway - plant csat04070   Phosphatidylinositol signaling system csat04075   Plant hormone signal transduction csat04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:csat00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     104780249    04070 Phosphatidylinositol signaling system     104780249    04075 Plant hormone signal transduction     104780249  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     104780249  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csat01009]     104780249   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csat04131]     104780249    03036 Chromosome and associated proteins [BR:csat03036]     104780249   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csat04147]     104780249 Protein phosphatases and associated proteins [BR:csat01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104780249 Membrane trafficking [BR:csat04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104780249 Chromosome and associated proteins [BR:csat03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104780249 Exosome [BR:csat04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104780249 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 SAPC2_N UPF0154 DUF5580_M Dockerin_1 RNA_pol_Rpb4 EFhand_Ca_insen EF-hand_EFHB_C Caleosin MotA_activ FCaBP_EF-hand EF-hand_STIM1 SPEF2_C PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  104780249 NCBI-ProteinID:  XP_010503055 UniProt:  A0ABM0TFX7 LinkDB All DBs Position 4:complement(11096601..11098061) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagcttaccgatgaccagatctcagagttcaaggaagctttcagcctattc gacaaggacggagatggttgtatcacaactaaggagcttgggacggtgatgagatcactt gggcagaacccaacagaagctgagctccaggacatgatcaacgaagtggatgcagatggt aacgggacgatagatttccctgagttcttgaaccttatggcacgcaagatgaaagacact gattcagaggaggagcttaaggaagccttcagggtttttgacaaggaccagaacggtttc atctccgctgctgaactccgccatgtcatgacaaatcttggggagaagctgacggatgag gaagtcgatgagatgatccgagaggctgatgtcgatggtgatggtcagattaactacgaa gagttcgtcaaagtcatgatggcaaagtga

DBGET integrated database retrieval system