KEGG   Camelina sativa (false flax): 104785741
Entry
104785741         CDS       T05044                                 
Name
(RefSeq) cystine lyase CORI3-like
  KO
K21623  L-cystine beta-lyase [EC:4.4.1.35]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00270  Cysteine and methionine metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104785741
Enzymes [BR:csat01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.35  L-cystine beta-lyase
     104785741
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase DUF4452
Other DBs
NCBI-GeneID: 104785741
NCBI-ProteinID: XP_010509309
LinkDB
Position
5:complement(5991133..5993470)
AA seq 423 aa
MANDRSVDWKFSGSEAAKEASAASLGTYSSKLFALCDPLGKPILPPRSKSAETSHTAEKA
VVEAVLCGTGNAYAPSLGLPVARSAVAEYLNRDLPKKLTADDVFMTVGGKQAIELTVDIL
AKPKANVLLPKPGFPWDVVRTIYKNLEVRKYDFIPEQNYEIDFDSVRALVDENTFAIFII
NPHNPNGNTYSEVHLKKLAELARELRIMVVSDEVFRWTVFGSNPFVPMGKFSSIVPVVTL
GSISKGWIVPGWRTGWVALHDLDGVFKCTKVLTAAKQFLVINSKPPTVIQAALPTILENT
PEEFFHKRQKFLKEKADFAYSKLKEIPTLTCYLKPEACTFLWTELNLSRFADIKDDEEFC
EKLATEENLVLLPGIAFGLKNWARHSIDMEISTLEDALGRLKSFCERHSIIIEVPLKDVN
GVK
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggcgaacgatagatccgtcgactggaagtttagtggtagtgaagcagccaaagaggct
tcagctgcctcgttaggcacttactcctctaaactctttgctctgtgtgaccctcttgga
aaacccattttgccccctcgaagcaaatctgccgagactagccataccgctgagaaggct
gttgttgaagccgtcctttgcggtactggaaacgcctatgctccaagtcttggccttccc
gtggctagaagtgccgtggcagagtatcttaatcgagatctaccgaagaaactgacagca
gatgacgtgtttatgaccgttggaggcaaacaagccatcgagcttacagtcgatatctta
gctaaaccaaaagccaacgttttgcttccaaagccgggcttcccatgggacgtggtccgc
accatctacaagaatcttgaggttcgaaaatatgatttcatccccgaacagaactatgag
atcgactttgacagcgtccgtgcgcttgtggacgagaacacatttgcgatatttattatt
aacccacacaatcctaatgggaacacgtactcagaagttcatctcaagaagttggctgag
ttggctcgggaactaaggataatggtggtttctgacgaagtttttagatggactgtgttt
gggagtaatccctttgttcccatggggaaattctcgtctatcgtaccagtggttacactc
ggttctatatcgaagggatggattgtaccaggatggcgaaccggctgggtcgcgctgcac
gatctagatggtgtctttaagtgcaccaaggtcttaactgctgctaagcaatttctggtg
ataaattctaaaccaccaactgttatccaggcagctcttcccaccatcttggagaatact
cctgaagagttctttcataagaggcagaaatttctgaaagagaaagctgattttgcatat
tctaagctcaaagagataccaaccctaacatgctacttgaaacctgaagcttgcaccttc
ttatggaccgagctgaacttgtcaagatttgcggacattaaagatgatgaagaattctgt
gaaaagcttgctactgaagaaaaccttgtccttttaccagggattgcttttggtctgaag
aactgggcgaggcattctatcgacatggagatttcgacattggaggatgcacttggaaga
ttgaagagcttctgtgaacgccactccattataattgaagttccactcaaagatgtcaat
ggtgtcaagtaa

DBGET integrated database retrieval system