Camelina sativa (false flax): 104790084
Help
Entry
104790084 CDS
T05044
Name
(RefSeq) SKP1-like protein 14
KO
K03094
S-phase kinase-associated protein 1
Organism
csat
Camelina sativa (false flax)
Pathway
csat03083
Polycomb repressive complex
csat04120
Ubiquitin mediated proteolysis
csat04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
csat00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
104790084
04120 Ubiquitin mediated proteolysis
104790084
09126 Chromosome
03083 Polycomb repressive complex
104790084
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
csat04131
]
104790084
04121 Ubiquitin system [BR:
csat04121
]
104790084
03036 Chromosome and associated proteins [BR:
csat03036
]
104790084
Membrane trafficking [BR:
csat04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
104790084
Ubiquitin system [BR:
csat04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
104790084
Cul7 complex
104790084
Chromosome and associated proteins [BR:
csat03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
104790084
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
104790084
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
Skp1
Motif
Other DBs
NCBI-GeneID:
104790084
NCBI-ProteinID:
XP_010514085
UniProt:
A0ABM0ZD57
LinkDB
All DBs
Position
6:1712037..1712752
Genome browser
AA seq
162 aa
AA seq
DB search
MSSNKVVLTSSDGVTFEIEEAVARKLQIIGHMIDDDCADKAIPLANVTGKILALVIEYCK
KHVDDKDSTKEEEAKAEELKTWDVEFMKNIDIETTFSIILAANYLNVKDLLDLTCQSVAD
HIKDMSPEEIRTIFNIECDFTPEEEANIRKENAWAFEPEPKP
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgtcttcgaacaaggttgtgttgactagctccgatggtgtaactttcgagattgaagaa
gcggtggctcgtaaattgcagatcatagggcacatgatcgacgatgactgcgccgataaa
gcaatcccgctggcgaacgtcactggtaagatcctcgcactggtcatcgagtattgcaag
aaacacgtcgatgataaagattcaaccaaggaagaggaagccaaggcggaggagctcaag
acttgggacgtagagttcatgaaaaatattgatatcgaaacaaccttctcaatcattctc
gctgctaactatctcaacgtcaaagaccttctcgatctcacttgccagagcgttgcagat
cacatcaaagacatgtcgccagaggagattcgaacgatcttcaacatcgagtgcgatttc
acacccgaagaagaagcaaatattcgaaaggagaacgcgtgggcttttgaacctgaacca
aaaccctaa
DBGET
integrated database retrieval system