Camelina sativa (false flax): 104791969 Help Entry 104791969         CDS       T05044                                  Name (RefSeq) calmodulin-5   KO K02183   calmodulin Organism csat  Camelina sativa (false flax) Pathway csat04016   MAPK signaling pathway - plant csat04070   Phosphatidylinositol signaling system csat04075   Plant hormone signal transduction csat04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:csat00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     104791969    04070 Phosphatidylinositol signaling system     104791969    04075 Plant hormone signal transduction     104791969  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     104791969  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csat01009]     104791969   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csat04131]     104791969    03036 Chromosome and associated proteins [BR:csat03036]     104791969   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csat04147]     104791969 Protein phosphatases and associated proteins [BR:csat01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104791969 Membrane trafficking [BR:csat04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104791969 Chromosome and associated proteins [BR:csat03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104791969 Exosome [BR:csat04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104791969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 DUF5580_M UPF0154 Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand SurA_N_3 SurA_N_2 PA_Ig-like Fe_hyd_lg_C DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  104791969 NCBI-ProteinID:  XP_010516281 LinkDB All DBs Position 6:complement(17506375..17507658) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIKEADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctcaccgacgatcagatctctgagtttaaggaagctttcagcttattc gacaaggatggtgatggttgcattaccaccaaggagctgggtactgtgatgcgttcactt ggacaaaacccaaccgaagctgagcttcaagacatgatcaatgaagttgacgctgatggt aacggcaccattgatttcccagagtttttgaacctcatggctcgtaagatgaaggacact gactctgaggaagagctcaaggaagcgttcagggtctttgacaaggaccagaacggtttc atctcagctgctgagcttcgtcatgtgatgacaaaccttggtgagaagctcactgatgaa gaagttgatgagatgatcaaggaagctgatgttgatggtgatggtcagattaactatgaa gagtttgtcaaggtcatgatggctaagtag

DBGET integrated database retrieval system