Cannabis sativa (hemp): 115700788 Help Entry 115700788         CDS       T08987                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism csav  Cannabis sativa (hemp) Pathway csav04136   Autophagy - other Brite KEGG Orthology (KO) [BR:csav00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     115700788  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csav04131]     115700788    04121 Ubiquitin system [BR:csav04121]     115700788    03029 Mitochondrial biogenesis [BR:csav03029]     115700788 Membrane trafficking [BR:csav04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     115700788 Ubiquitin system [BR:csav04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    115700788 Mitochondrial biogenesis [BR:csav03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     115700788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 DUF4264 Motif Other DBs NCBI-GeneID:  115700788 NCBI-ProteinID:  XP_030484293 UniProt:  A0A803RBT5 LinkDB All DBs Position 8:50749538..50751055 Genome browser AA seq 97 aa AA seqDB search MATITMDSPTAVRKVVVHLRATGDAPILKQAKFKIPGTDKFAKVIDFLRRQLHRDTMFVY VNSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggctactattactatggactctcctacagctgttcgaaaagtggttgttcatctgaga gccactggtgatgctcccattctgaagcaagcaaagttcaagatacctggaactgacaaa ttcgccaaagttatcgactttttaagacgacaacttcatcgagacaccatgtttgtgtat gtgaacagtgcattctcaccaaaccctgatgaatctgtcattgatctttacaacaatttc ggtttcgatggtaaactagttgtcaactatgcttgttctatggcctggggttaa

DBGET integrated database retrieval system