Caldicellulosiruptor saccharolyticus: Csac_1606 Help Entry Csac_1606         CDS       T00506                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csc  Caldicellulosiruptor saccharolyticus Pathway csc01100   Metabolic pathways csc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Csac_1606    00074 Mycolic acid biosynthesis     Csac_1606   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Csac_1606 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Arc Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABP67198 UniProt:  A4XJW3 LinkDB All DBs Position 1763977..1764213 Genome browser AA seq 78 aa AA seqDB search MNSEIFEKVRKIIADKLDIEEDKITPESSFLDDLGADSLDIVELIMELEEEFNIEIPDED AEKIRTVADAVKYIEEHQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgaacagtgaaatctttgaaaaggtaagaaaaattattgcagacaaacttgacattgaa gaggacaaaattacacctgagtcatcattcttagatgaccttggtgcagattctttggac attgttgaacttatcatggagcttgaagaggaattcaacattgaaattccagatgaagat gcggaaaagattagaacagttgccgatgcagtgaaatatattgaagagcatcaataa

DBGET integrated database retrieval system