Caldicellulosiruptor saccharolyticus: Csac_2044 Help Entry Csac_2044         CDS       T00506                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism csc  Caldicellulosiruptor saccharolyticus Pathway csc02024   Quorum sensing csc03018   RNA degradation Brite KEGG Orthology (KO) [BR:csc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Csac_2044  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Csac_2044  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csc03019]     Csac_2044    03036 Chromosome and associated proteins [BR:csc03036]     Csac_2044 Messenger RNA biogenesis [BR:csc03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Csac_2044 Chromosome and associated proteins [BR:csc03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Csac_2044 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Pox_A32 Motif Other DBs NCBI-ProteinID:  ABP67629 UniProt:  A4XL44 LinkDB All DBs Position complement(2188963..2189262) Genome browser AA seq 99 aa AA seqDB search MAKGNLNLQDLFLNQLRKEKVNVTIFLLSGFQLKGVIKGFDNFTLVVETENNKQQLIYKH AISSILPSKPINYMAQVQNSQVQNTASQQSNNNQNQESK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt gtggcaaaaggaaatttgaacttgcaggatttatttttaaaccagcttcgaaaagaaaaa gtcaacgttacaatctttttactgagcggattccaattgaaaggagttatcaaaggtttt gataactttacattggtggtagagacagaaaataacaaacagcagctcatttacaaacat gcaatttcttctattctaccatcaaagccaataaactacatggctcaagttcaaaactca caagtgcaaaacacagcttctcagcaaagtaacaataaccaaaatcaagagtcaaaataa

DBGET integrated database retrieval system