Clostridium scindens: HDCHBGLK_02621 Help Entry HDCHBGLK_02621    CDS       T06591                                  Symbol tilS_2 Name (GenBank) tRNA(Ile)-lysidine synthase   KO K09457   7-cyano-7-deazaguanine reductase [EC:1.7.1.13] Organism csci  Clostridium scindens Pathway csci00790   Folate biosynthesis csci01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:csci00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HDCHBGLK_02621 (tilS_2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:csci03016]     HDCHBGLK_02621 (tilS_2) Enzymes [BR:csci01000]  1. Oxidoreductases   1.7  Acting on other nitrogenous compounds as donors    1.7.1  With NAD+ or NADP+ as acceptor     1.7.1.13  preQ1 synthase      HDCHBGLK_02621 (tilS_2) Transfer RNA biogenesis [BR:csci03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     HDCHBGLK_02621 (tilS_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  QueC tRNA_Me_trans ATP_bind_3 Asn_synthase NAD_synthase Arginosuc_synth Motif Other DBs NCBI-ProteinID:  QBF75212 UniProt:  A0A494WME1 LinkDB All DBs Position 2564524..2564829 Genome browser AA seq 101 aa AA seqDB search MNLHEFFTDHPRVAIAFSGGVDSAYLLYAAKQYAKDVCAYYVKSAFQPQFELNDALHIAT DLGVKMEIIELNILACKLRLNGISVPHARNGYSIFSGTKYY NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaatttacatgagttttttacggaccatccaagagtggcaattgctttttccggagga gttgactcggcatatcttttatatgcagctaagcaatatgcgaaagacgtatgcgcctat tatgtgaaatcagcttttcaaccacagtttgagctgaatgatgctttgcacattgccact gatttgggtgtgaaaatggaaataatagaattaaatattcttgcctgtaaattacggttg aatgggatttccgttccgcatgcgcggaacggctattccatttttagcggtacaaaatac tattga

DBGET integrated database retrieval system