Cryptotermes secundus (drywood termite): 111861297 Help Entry 111861297         CDS       T07421                                  Name (RefSeq) LIRP   KO K04526   insulin Organism csec  Cryptotermes secundus (drywood termite) Pathway csec04068   FoxO signaling pathway csec04081   Hormone signaling csec04140   Autophagy - animal csec04150   mTOR signaling pathway csec04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:csec00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     111861297    04150 mTOR signaling pathway     111861297   09133 Signaling molecules and interaction    04081 Hormone signaling     111861297  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111861297  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     111861297  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csec04052]     111861297 Cytokines and neuropeptides [BR:csec04052]  Neuropeptides   Unclassified    111861297 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta TRAPP Motif Other DBs NCBI-GeneID:  111861297 NCBI-ProteinID:  XP_023701503 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search MWRLCLQLVAIAALCLCTLAEAQSGLFQLADKRYTNKYCGRKLSNMLQFVCNGNYYPMFK KTSQDVEDMNDSDFWIQTTPIDEQEVQFPFRSRSKAVTAVPGSFRRHTRGVYDECCRKSC TIQEMASYCGR NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgtggaggctctgcctgcaactggtggccattgcagcactttgtctatgcacccttgcc gaagctcaatcaggcttattccaattagcagacaaaagatatacaaataaatattgtggc aggaaactatcaaacatgcttcaatttgtgtgtaatggaaattactacccaatgttcaag aagacatcacaagatgtggaagacatgaatgactctgatttctggatacagactacgcct atagatgaacaggaagtacagtttccattccgttcaagatcaaaggcagtaacagctgtg cctggatcattcagaagacatacacgcggagtttatgatgaatgttgtcgcaaaagttgt acaatacaagaaatggcaagctattgtggaagatga

DBGET integrated database retrieval system