Cryptotermes secundus (drywood termite): 111865897 Help Entry 111865897         CDS       T07421                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism csec  Cryptotermes secundus (drywood termite) Pathway csec04145   Phagocytosis csec04814   Motor proteins Brite KEGG Orthology (KO) [BR:csec00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     111865897   09142 Cell motility    04814 Motor proteins     111865897  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:csec03037]     111865897    04812 Cytoskeleton proteins [BR:csec04812]     111865897 Cilium and associated proteins [BR:csec03037]  Motile cilia and associated proteins   Dynein arm    111865897 Cytoskeleton proteins [BR:csec04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      111865897 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 DUF8640 Motif Other DBs NCBI-GeneID:  111865897 NCBI-ProteinID:  XP_023710103 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MEEVASDETQFVVDEVSTIIKEAIENSIGGNAYQHNKVNQWTSSVVEACLGALTKLQKPF KYIVTCTIMQKNGAGLHTASSCFWDNSTDGSCTVRWENKTMYCIVSVFGLAI NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggaagaggtagcgagcgacgaaacacaatttgtggtggacgaagttagcaccataatt aaagaagcaatagaaaattctattggaggaaatgcgtatcaacacaacaaagtcaaccaa tggacatcatctgtcgtcgaagcgtgtttaggagccttgaccaaactacaaaaaccattt aaatatattgtgacctgtaccataatgcagaagaatggtgcaggacttcacaccgcgagc tcatgtttctgggacaacagtacagatggcagctgcacagttcgttgggagaacaagacc atgtactgtatcgtatctgtgtttggtctggccatctag

DBGET integrated database retrieval system