KEGG   Cryptotermes secundus (drywood termite): 111869190
Entry
111869190         CDS       T07421                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
csec  Cryptotermes secundus (drywood termite)
Pathway
csec00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:csec00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    111869190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:csec00199]
    111869190
Enzymes [BR:csec01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     111869190
Cytochrome P450 [BR:csec00199]
 Cytochrome P450, animal type
  CYP306 family
   111869190
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111869190
NCBI-ProteinID: XP_023716252
LinkDB
Position
Unknown
AA seq 507 aa
MGRDHWMDEDKSLVYSALLLVVASSVAVLWFLKRRGPPVPPGPCGVPLLGFLPWIDPKAP
HLTFTRLAKHYGPIYSLKLGNVFTVVLSDPHLIRQAFAKDIFVGRAPLYLTHGIMKGNGL
ICAEGELWKDQRKFVTVCLRNFGMIKFGSKRERLEKRILVGVQECLEMLGRNSNAVEPLP
IILHCIGNVMNSLVFGVSYAENDPMWKWLQQLQDEGLKYIGVTGILNFLPILRFIPKFKK
PMNFLMEGKMKSHEYYHTIILDRMKKRKSFPGDDENYLADNIIDSFLDEKERRGEGDKGF
YNTTQFHHLLGDMFGAGLDTTMTTLRWFVLFMAANSGAQKRVQAELDSVVGSRLPTLEDL
PLLPYTEAALAETQRIRSVVPVGIPHGALAATTFAGYHIPKGTMIMPLQWAVHMDPNQWP
EPERFSPERFLTTEGQFNRPESFIPFQTGKRMCVGEELARMMLFLFGSAIIQKFNITAPD
NIDIDLEGECGFTLAPKPQKLIFIPRV
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgggtcgagatcattggatggacgaagacaagtccctcgtttactcggccttgttgctg
gtcgtcgcatcttccgttgcagtgctttggtttctgaaacgtcgtgggccacctgttcct
ccgggtccctgtggggtccctctactgggattcttaccttggattgacccaaaggctcct
catctgaccttcacccgtttagcaaagcactacggtcccatttactccctgaagttggga
aatgtgttcaccgtggtattgtcagacccacatctcatcagacaagcttttgctaaggat
atcttcgtggggcgggccccactctatctcacgcatggcatcatgaagggcaacgggctg
atctgtgctgaaggcgaactttggaaagaccagcgtaaatttgttacagtatgtctaaga
aactttggcatgatcaaatttggttctaaaagagagagattggagaagagaatattagtt
ggtgtccaggagtgccttgagatgcttgggaggaattcgaacgcagtggaacctctaccg
ataatacttcactgtataggcaacgttatgaactccttggtcttcggtgtctcctacgct
gagaatgatcccatgtggaaatggttgcagcaactccaggatgaaggcttaaaatatata
ggtgttacggggatcctcaattttcttcccattttaaggtttattccgaaattcaagaaa
ccgatgaattttttgatggaagggaaaatgaaatcacatgagtattatcacacaattata
ctggatcgtatgaagaaacgaaagtccttcccgggagatgatgaaaattaccttgcagac
aatataatcgactcttttctggacgaaaaggaacggcgtggggaaggggacaaaggattc
tacaacacaactcagttccaccatcttcttggtgatatgttcggagcgggactggacaca
acgatgaccaccctgcgatggtttgtcctcttcatggcggcgaattccggcgcacagaag
agagtccaagcagaattagacagtgtagttggctcccgtttgccaactcttgaggaccta
ccattgctaccctacactgaagccgctcttgctgagacccaaaggatccgctctgttgta
ccagtcggaataccacatggagcgttggcggccaccacttttgcaggctatcacattccg
aagggcaccatgataatgcctctacagtgggctgtacatatggatcccaaccaatggcca
gaaccggagcgtttcagtcctgagcggtttctaacaactgagggtcaattcaacagacca
gaaagcttcattccttttcagacaggtaagaggatgtgtgttggagaagaattagccagg
atgatgctgtttttatttggatcagccatcattcagaaattcaacatcactgcaccagat
aacattgacatcgatctagagggtgaatgtggatttacacttgccccgaaacctcaaaaa
ctgatttttattcctagagtatga

DBGET integrated database retrieval system