Cryptotermes secundus (drywood termite): 111873155 Help Entry 111873155         CDS       T07421                                  Name (RefSeq) ras-like GTP-binding protein RHO   KO K04513   Ras homolog gene family, member A Organism csec  Cryptotermes secundus (drywood termite) Pathway csec04081   Hormone signaling csec04144   Endocytosis csec04150   mTOR signaling pathway csec04310   Wnt signaling pathway csec04350   TGF-beta signaling pathway csec05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:csec00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111873155    04350 TGF-beta signaling pathway     111873155    04150 mTOR signaling pathway     111873155   09133 Signaling molecules and interaction    04081 Hormone signaling     111873155  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111873155  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111873155  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csec04131]     111873155   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csec04147]     111873155    04031 GTP-binding proteins [BR:csec04031]     111873155 Membrane trafficking [BR:csec04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     111873155 Exosome [BR:csec04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111873155   Exosomal proteins of other body fluids (saliva and urine)    111873155   Exosomal proteins of colorectal cancer cells    111873155   Exosomal proteins of bladder cancer cells    111873155 GTP-binding proteins [BR:csec04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     111873155 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  111873155 NCBI-ProteinID:  XP_023723401 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MSAIRKKLVVVGDGACGKTCLLTVFSKDRFPDFYVPTIFESAVADIEVDGNQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSFRNILNKWTPEVRHFCPNVPIILVANKKD LRCEPTIISELGKMKQSPINTVDGKAMAEKINAFSFLECSAKNMEGVREVFETATRAALQ VNKKKKKGCCGLM NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgtcggcgatccggaagaaattggttgtcgtaggggatggtgcgtgtggaaagacttgt ctcctaacagtttttagcaaagatagatttccggatttttatgttcccacaatattcgag agtgctgttgcagatatagaagtggatggaaatcaagtcgaattagccttgtgggatacc gccggtcaagaggattatgataggttacgaccgttatcatatcctgatactgatgttatt ctaatgtgtttttcaatagattccccggattcttttcgtaatattctcaataagtggacc ccggaggttagacatttctgtcctaatgtacccattattctagtcgctaataaaaaggat ttgagatgtgagccaaccattatatcagaactgggtaaaatgaagcaaagtccgattaat acagtggatggtaaagcgatggcagaaaagataaatgcatttagcttcttggaatgttct gcaaagaatatggagggcgttcgtgaagtttttgaaaccgctacaagggccgcccttcaa gtgaataaaaagaaaaagaagggttgctgtggtttgatgtaa

DBGET integrated database retrieval system