Cryptotermes secundus (drywood termite): 111873428 Help Entry 111873428         CDS       T07421                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism csec  Cryptotermes secundus (drywood termite) Pathway csec04013   MAPK signaling pathway - fly csec04145   Phagosome csec04148   Efferocytosis csec04310   Wnt signaling pathway csec04517   IgSF CAM signaling csec04518   Integrin signaling csec04620   Toll-like receptor signaling pathway csec05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:csec00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     111873428    04310 Wnt signaling pathway     111873428   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     111873428    04518 Integrin signaling     111873428  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111873428    04148 Efferocytosis     111873428  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111873428  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111873428  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csec04131]     111873428   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csec04147]     111873428    04031 GTP-binding proteins [BR:csec04031]     111873428 Membrane trafficking [BR:csec04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111873428  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111873428   Macropinocytosis    Ras GTPases     111873428  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111873428 Exosome [BR:csec04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111873428   Exosomal proteins of other body fluids (saliva and urine)    111873428   Exosomal proteins of colorectal cancer cells    111873428   Exosomal proteins of bladder cancer cells    111873428 GTP-binding proteins [BR:csec04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111873428 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  111873428 NCBI-ProteinID:  XP_023723920 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKETIEKLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRKCILL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcaattaaatgtgttgtggtaggagatggtgcggttggtaagacgtgtctactg atcagctacaccacaaatgccttccctggggaatacatccctacagtattcgataattac tcagctaatgttatggtagatggcaaaccaatcaacttaggattgtgggatacagcagga caggaagactatgacaggttgcgcccactatcctacccacagactgatgttttcctcatt tgcttttcactagtgaacccagcgtcatttgagaatgtaagagcaaagtggtaccctgag gtgcgacatcactgtccaagtacccccatcatccttgttggcactaagctcgacttgcga gaagacaaggaaacgattgagaagctaaaggataagaagttagcccccatcacatatcct cagggtctagccatggcgaaggagattggtgctgtaaagtacctggagtgcagtgcatta actcagaagggtctgaagacggtatttgatgaagcgattcgggccgtcctgtgccctgtt ctccaagtgaaaccaaaacggaaatgcatcttgctgtag

DBGET integrated database retrieval system