Cynoglossus semilaevis (tongue sole): 103379257 Help Entry 103379257         CDS       T04866                                  Name (RefSeq) histone H2B.3   KO K11252   histone H2B Organism csem  Cynoglossus semilaevis (tongue sole) Brite KEGG Orthology (KO) [BR:csem00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csem03036]     103379257   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csem04147]     103379257 Chromosome and associated proteins [BR:csem03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103379257 Exosome [BR:csem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103379257 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID TAF Motif Other DBs NCBI-GeneID:  103379257 NCBI-ProteinID:  XP_008308968 LinkDB All DBs Position 5:15399480..15399962 Genome browser AA seq 67 aa AA seqDB search MSIMNSFVNDVFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcatcatgaactcgttcgtcaacgacgtgttcgaacgcatcgcctctgaggcttcc cgcctggcccattacaacaagcgctccaccatcacatccagggagatccagaccgctgtt cgtctgctgctgcccggtgagctggccaagcacgccgtgtctgagggaaccaaggccgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system