Cynoglossus semilaevis (tongue sole): 103379728 Help Entry 103379728         CDS       T04866                                  Name (RefSeq) CD59 glycoprotein-like   KO K04008   CD59 antigen Organism csem  Cynoglossus semilaevis (tongue sole) Brite KEGG Orthology (KO) [BR:csem00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csem04147]     103379728    04090 CD molecules [BR:csem04090]     103379728    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:csem00537]     103379728 Exosome [BR:csem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103379728   Exosomal proteins of other body fluids (saliva and urine)    103379728   Exosomal proteins of colorectal cancer cells    103379728 CD molecules [BR:csem04090]  Proteins   103379728 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:csem00537]  Antigens   103379728 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  103379728 NCBI-ProteinID:  XP_008309600 LinkDB All DBs Position 6:complement(4683591..4685665) Genome browser AA seq 101 aa AA seqDB search MFHLGSSLKCYDCLNRNCENTKECTTEDACLSLTAGENIVRQCIKYSDCNFDLLSIKFPT FSGFKFSCCQTNLCNSGHALKMTTPILVLLGALLSVIWSWI NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtttcacctgggatccagtctcaagtgctacgactgcttaaacaggaactgtgagaac accaaggagtgcaccactgaggacgcctgcctgtctctgactgcaggagaaaatattgtt cgtcagtgtatcaagtattcagactgcaacttcgacctcctctctatcaagtttccaact ttctccgggttcaagttcagctgctgccagacaaacctctgcaactccggccacgccctc aaaatgaccacacccatcctggtgctgctgggggcgctgctgagtgttatttggtcttgg atttaa

DBGET integrated database retrieval system