Cynoglossus semilaevis (tongue sole): 103380387 Help Entry 103380387         CDS       T04866                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04010   MAPK signaling pathway csem04012   ErbB signaling pathway csem04068   FoxO signaling pathway csem04137   Mitophagy - animal csem04140   Autophagy - animal csem04144   Endocytosis csem04150   mTOR signaling pathway csem04210   Apoptosis csem04218   Cellular senescence csem04370   VEGF signaling pathway csem04371   Apelin signaling pathway csem04510   Focal adhesion csem04540   Gap junction csem04625   C-type lectin receptor signaling pathway csem04810   Regulation of actin cytoskeleton csem04910   Insulin signaling pathway csem04912   GnRH signaling pathway csem04916   Melanogenesis csem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csem00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     103380387 (hras)    04150 mTOR signaling pathway     103380387 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103380387 (hras)    04140 Autophagy - animal     103380387 (hras)    04137 Mitophagy - animal     103380387 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csem04131]     103380387 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csem04147]     103380387 (hras)    04031 GTP-binding proteins [BR:csem04031]     103380387 (hras) Membrane trafficking [BR:csem04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103380387 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     103380387 (hras) Exosome [BR:csem04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103380387 (hras)   Exosomal proteins of colorectal cancer cells    103380387 (hras) GTP-binding proteins [BR:csem04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103380387 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  103380387 NCBI-ProteinID:  XP_008310555 UniProt:  A0A3P8VDJ5 LinkDB All DBs Position 6:14749004..14768155 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaagctggtagtggttggcgctggaggcgtgggcaagagtgcactcacc attcagctaatccagaaccactttgtagatgaatatgatccaaccatagaggactcatac aggaaacaagtggtcattgacggggagacctgcctgctggatatccttgatactgcaggt caggaggagtacagcgcaatgagggaccagtacatgaggacaggcgagggtttcctctgt gtgtttgccattaataacaccaaatcttttgaggacattcaccagtacagagaacagatt aaacgtgtgaaagactcagacgatgtccccatggtacttgtgggaaacaaatgtgacctc ccagcacgtaccgtggacacaaggcaagcccaggaacttgcccgctcctatgggatacct tacattgagacctctgccaagacacggcagggagtagaggatgccttttacacattggtc agggagatcaggcagcataagctgagaaagctgaacccacctgatgagagcggtcaggat tgtatgagctgtcgctgtgtggtatcatga

DBGET integrated database retrieval system