Cynoglossus semilaevis (tongue sole): 103388327 Help Entry 103388327         CDS       T04866                                  Symbol txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04621   NOD-like receptor signaling pathway csem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csem00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103388327 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103388327 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:csem03110]     103388327 (txn) Chaperones and folding catalysts [BR:csem03110]  Protein folding catalysts   Protein disulfide isomerase    103388327 (txn) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin OST3_OST6 Thioredoxin_8 AhpC-TSA Thioredoxin_7 Thioredoxin_2 DIM1 Thioredoxin_9 Redoxin TXD17-like_Trx PedC-like RE_AspBHI_N HyaE YwrJ_3rd AF_1314_N Glutaredoxin Motif Other DBs NCBI-GeneID:  103388327 NCBI-ProteinID:  NP_001281155 UniProt:  I3VA01 LinkDB All DBs Position 1 Genome browser AA seq 107 aa AA seqDB search MVYEVKDYNDFTQQLKRAGNKLVVVDFTATWCQPCKNISPVFEELANQYKNVVFLKVDVD EADDVSTECEINCMPTFLFYRNEKRVHSFSGANSDTLRAAVKQYEKE NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtttacgaagtgaaagattacaatgacttcactcagcagctgaagagagctggaaac aaactggtggtggtggacttcacagcgacatggtgccaaccctgcaaaaacatatctccc gtgtttgaagaactggcaaatcagtataagaacgtggttttcctgaaggtggatgtagat gaggctgacgacgtcagtacagaatgtgaaatcaactgcatgcccacattcctcttttat aggaacgaaaagcgggtgcactccttttcaggtgcaaactcggacacactgagggctgca gtgaagcagtatgaaaaagaataa

DBGET integrated database retrieval system