Cynoglossus semilaevis (tongue sole): 103390377 Help Entry 103390377         CDS       T04866                                  Name (RefSeq) myosin light chain 5-like   KO K12753   myosin regulatory light chain 5 Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04510   Focal adhesion csem04520   Adherens junction csem04810   Regulation of actin cytoskeleton csem04814   Motor proteins csem04820   Cytoskeleton in muscle cells csem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csem00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103390377    04520 Adherens junction     103390377   09142 Cell motility    04814 Motor proteins     103390377    04820 Cytoskeleton in muscle cells     103390377    04810 Regulation of actin cytoskeleton     103390377  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103390377  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:csem04812]     103390377 Cytoskeleton proteins [BR:csem04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      103390377 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EFhand_Ca_insen EH AIF-1 MecA_N Motif Other DBs NCBI-GeneID:  103390377 NCBI-ProteinID:  XP_008324434 LinkDB All DBs Position 14:complement(27330863..27332442) Genome browser AA seq 148 aa AA seqDB search MFEQTQIQEFKEAFTLIDQNRDGFIDKEDLKDTYASLGKLNVKDNELEDMLKEATGPINF TMFLNLFGEKLHGTDPEDTILNAFKLFDPDAKGYVQKDELQTLLMTQADRFSAEEVKQMF QSSDIDPAGNLDYKSLCYIITHGEQQEE NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgtttgaacaaactcagatccaggagttcaaggaggcgttcacactgatcgaccaaaac cgtgacggattcattgacaaggaggatctgaaggacacgtacgcttctctggggaaactc aacgtgaaggacaacgagctggaggacatgctgaaggaagctacaggtcccatcaacttc acgatgttcctcaacctgtttggagaaaaactccacggcaccgaccctgaggacaccatt ttaaatgctttcaaattgtttgaccccgatgctaaaggctacgtccaaaaggacgaatta cagacgttactgatgacgcaggccgacaggttctcagccgaggaggtgaagcagatgttc cagtcatcagacatcgaccctgcaggaaacctggattataaatctctgtgttacatcatc acacacggcgaacagcaggaggaatga

DBGET integrated database retrieval system