Cynoglossus semilaevis (tongue sole): 103394520 Help Entry 103394520         CDS       T04866                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04382   Cornified envelope formation csem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csem00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103394520  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103394520  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csem04147]     103394520 Exosome [BR:csem04147]  Exosomal proteins   Exosomal proteins of microglial cells    103394520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg Enolase_N Motif Other DBs NCBI-GeneID:  103394520 NCBI-ProteinID:  XP_008330087 LinkDB All DBs Position 18:12611176..12612699 Genome browser AA seq 97 aa AA seqDB search MPSELEIAMESLITVFHRYAKDGRLNRAELRKLMENELSNFLRSQKDPAAVDKIMKDLDA NGDNQVDFEEFVSLVVGLSIACEQCYAAQMKQRSFRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaaatcgccatggagtccctcatcacggtgttccaccgttacgcc aaggacggcagactcaaccgcgctgaactgaggaagttgatggagaacgagctgtccaac ttcctgaggtctcagaaagaccctgctgctgtggacaagatcatgaaggacctagacgcc aacggcgacaaccaagtggactttgaggagtttgtttctctggttgtgggactatcgatt gcctgtgagcaatgctacgctgcacaaatgaagcaaaggagctttaggaagtaa

DBGET integrated database retrieval system