Cynoglossus semilaevis (tongue sole): 103395680 Help Entry 103395680         CDS       T04866                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04010   MAPK signaling pathway csem04068   FoxO signaling pathway csem04081   Hormone signaling csem04114   Oocyte meiosis csem04140   Autophagy - animal csem04150   mTOR signaling pathway csem04810   Regulation of actin cytoskeleton csem04910   Insulin signaling pathway csem04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:csem00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103395680 (ins)    04068 FoxO signaling pathway     103395680 (ins)    04150 mTOR signaling pathway     103395680 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     103395680 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103395680 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     103395680 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103395680 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103395680 (ins)    04914 Progesterone-mediated oocyte maturation     103395680 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csem04052]     103395680 (ins) Cytokines and neuropeptides [BR:csem04052]  Neuropeptides   Unclassified    103395680 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  103395680 NCBI-ProteinID:  XP_008331679 UniProt:  A0A3P8VEB9 LinkDB All DBs Position 19:complement(16943795..16944929) Genome browser AA seq 113 aa AA seqDB search MAALWLQTVSLLLLVAVSLSGSQPVAQHLCGSHLVDALYLVCGDRGFFYNPKRDVEPLLG FLAPKVGGATAGGDNEVAEYAFKDQMEMLVKRGIVEQCCHNRCSVPDLQNYCN NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcggcgctgtggctccagactgtctctctgctcctcctagtggccgtgtcgttgtcg ggctctcagcctgtggctcagcacctgtgcggctctcacctggtcgatgccctctacctg gtctgtggggacagaggcttcttctacaaccccaagagagacgtggagcctctgctgggt ttccttgctcctaaagtgggcggagccacggcaggtggcgacaacgaggtggctgaatat gccttcaaggaccagatggagatgttggtgaagcgaggcatcgtggaacagtgctgccac aaccgctgcagcgtccccgatctgcagaactactgcaactga

DBGET integrated database retrieval system