Comamonas serinivorans: CCO03_10485 Help Entry CCO03_10485       CDS       T04892                                  Name (GenBank) hypothetical protein   KO K02372   3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59] Organism cser  Comamonas serinivorans Pathway cser00061   Fatty acid biosynthesis cser00780   Biotin metabolism cser01100   Metabolic pathways cser01212   Fatty acid metabolism cser01240   Biosynthesis of cofactors Module cser_M00083   Fatty acid biosynthesis, elongation Brite KEGG Orthology (KO) [BR:cser00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCO03_10485   09108 Metabolism of cofactors and vitamins    00780 Biotin metabolism     CCO03_10485  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:cser01004]     CCO03_10485 Enzymes [BR:cser01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.1  Hydro-lyases     4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase      CCO03_10485 Lipid biosynthesis proteins [BR:cser01004]  Fatty acid synthase   Component type    CCO03_10485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ApeI-like FabA PKS_DH_N Motif Other DBs NCBI-ProteinID:  ARU05059 UniProt:  A0A1Y0EP07 LinkDB All DBs Position 2469010..2469315 Genome browser AA seq 101 aa AA seqDB search MFAGHFPGSPVLPGACLLDWAVAALSAHHAPQSVAWHCAWAKFPRAALPSDLLRLRWSAS AKGWGFTIERLGQAAGPLAEPAQPQAADTVASGLLVQAQAA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt gtgttcgcgggccactttccaggctcgccggtgctgcccggcgcctgcctgctcgactgg gcggtggcggcactcagcgcccaccacgcgccgcagtcggtcgcctggcactgtgcctgg gcgaaatttccccgcgccgccctgcccagcgacctgctgaggctgcgctggtccgccagt gccaagggctggggcttcaccatcgagcgcctggggcaggccgcgggtcccctggccgag ccggcgcaaccccaggctgccgacaccgtggccagcggcctgctggtgcaggcccaagcg gcgtga

DBGET integrated database retrieval system