Comamonas serinivorans: CCO03_12435 Help Entry CCO03_12435       CDS       T04892                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism cser  Comamonas serinivorans Pathway cser02024   Quorum sensing cser03018   RNA degradation Brite KEGG Orthology (KO) [BR:cser00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CCO03_12435  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CCO03_12435  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cser03019]     CCO03_12435    03036 Chromosome and associated proteins [BR:cser03036]     CCO03_12435 Messenger RNA biogenesis [BR:cser03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CCO03_12435 Chromosome and associated proteins [BR:cser03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CCO03_12435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ARU05388 UniProt:  A0A1Y0EPI4 LinkDB All DBs Position complement(2946538..2946783) Genome browser AA seq 81 aa AA seqDB search MSNKGQLLQDPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAI STIVPGRPVNLALNDAGEGQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtgagcaataaagggcaacttctacaagacccgtttctcaacaccctgcgtcgcgagcat gtgccagtgtccatttatttggtcaacggcatcaagctgcaaggtcagattgagtctttc gaccagtatgtggtcctcctgcgaaacacggtgacccagatggtgtacaagcacgccatc tcgaccattgttcccggccgccctgtgaacctggccctgaacgacgctggagaaggccag gcctga

DBGET integrated database retrieval system