Comamonas serinivorans: CCO03_13975 Help Entry CCO03_13975       CDS       T04892                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cser  Comamonas serinivorans Pathway cser01100   Metabolic pathways cser01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cser00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCO03_13975    00074 Mycolic acid biosynthesis     CCO03_13975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCO03_13975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARU05645 UniProt:  A0A1Y0EPS3 LinkDB All DBs Position 3288367..3288648 Genome browser AA seq 93 aa AA seqDB search MTDTHNQPADDTLIRELAELMVSSLNLEMAAEDIDPDAPLYGDGLGLDSIDILEIALAVS KQYGFQLKADDDNNARIFSSLRHLANHVAAQRV NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaccgacacacacaaccagcccgccgatgacaccctgatccgggagctggctgagctg atggtttcctccctcaacctggagatggccgccgaagacatcgaccccgacgccccgctg tacggcgacgggctgggcctggattccatcgacatcctggaaatcgccctggcggtctcg aaacagtacggcttccagctcaaggccgacgatgacaacaacgccaggatcttctccagc ctgcgccacctggccaaccacgtcgccgcgcagcgcgtctga

DBGET integrated database retrieval system