Campylobacter subantarcticus LMG 24377: CSUB8523_1587 Help Entry CSUB8523_1587     CDS       T03572                                  Symbol acpP3 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csf  Campylobacter subantarcticus LMG 24377 Pathway csf01100   Metabolic pathways csf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSUB8523_1587 (acpP3)    00074 Mycolic acid biosynthesis     CSUB8523_1587 (acpP3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSUB8523_1587 (acpP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJC93079 LinkDB All DBs Position 1557251..1557475 Genome browser AA seq 74 aa AA seqDB search MENKFYEILENILEVKVNENSNLSMQNCKNWTSLNHIDIIMSLEEEFEIKFSKDELSQLK SQNELLQAIKEKLC NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaaaataaattttatgaaattttagaaaatatactagaagtaaaagtcaatgaaaat tcgaatttaagtatgcaaaattgtaaaaattggacttctttaaatcatattgatataatc atgagcttagaagaagaatttgaaatcaaatttagtaaagatgaattaagtcagctaaaa tcacaaaatgaacttttgcaagctattaaggagaaattatgctag

DBGET integrated database retrieval system