Cylindrospermum stagnale: Cylst_1788 Help Entry Cylst_1788        CDS       T02398                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csg  Cylindrospermum stagnale Pathway csg01100   Metabolic pathways csg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Cylst_1788    00074 Mycolic acid biosynthesis     Cylst_1788   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Cylst_1788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFZ24049 UniProt:  K9WW58 LinkDB All DBs Position 2073836..2074087 Genome browser AA seq 83 aa AA seqDB search MSQADIFERVKKIVVEQLDVKPEQVVPDGSFTNDLGADSLDIVELVMALEEEFEIEIPDE AAEKILTVQEVVDYINHNVAASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccaagcagatatttttgaaagggtaaagaaaatcgtcgtcgagcaattggacgtt aagccggaacaagtcgtaccagacggcagttttacaaatgatttaggggctgattcctta gatatcgtagaactggtaatggctttggaagaagaatttgagatcgaaattcctgacgaa gccgccgaaaagattttaacggtccaagaggtagtggattacatcaaccataacgttgcc gcatccgcctaa

DBGET integrated database retrieval system