Clostridium saccharolyticum WM1: Closa_2197 Help Entry Closa_2197        CDS       T01288                                  Name (GenBank) conserved hypothetical protein   KO K02784   phosphocarrier protein HPr Organism csh  Clostridium saccharolyticum WM1 Pathway csh02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:csh00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     Closa_2197  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:csh02000]     Closa_2197 Transporters [BR:csh02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     Closa_2197 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  ADL04775 UniProt:  D9R2C5 LinkDB All DBs Position complement(2366051..2366314) Genome browser AA seq 87 aa AA seqDB search MKKVEIGFWGVESILEFVSIAGACKEKMNLACGDSMVNAKSLLSVLSLSAAGGLELIIHD DSCDSLLRLLELYVEHGRLLGNKHITV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaggtggagatcggattctggggagttgaatccatcctggagtttgtctcaata gcgggggcgtgtaaagaaaaaatgaatttggcttgcggggacagcatggtaaatgcaaaa tcattgctttcggtactgtctttgtccgctgcgggaggtttggaattgatcatacatgat gactcctgcgattctcttttaagacttctggaactgtatgttgagcatggaagactgctt ggcaacaagcatattacggtctga

DBGET integrated database retrieval system