Campylobacter showae: CSHOW_1358 Help Entry CSHOW_1358        CDS       T07015                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csho  Campylobacter showae Pathway csho01100   Metabolic pathways csho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSHOW_1358    00074 Mycolic acid biosynthesis     CSHOW_1358   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSHOW_1358 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QCD49277 LinkDB All DBs Position complement(1388857..1389114) Genome browser AA seq 85 aa AA seqDB search MNELIDEIKELIIKSLNLEDMKPSDIDENAPLFNEGLGLDSVDALELGLAVQKSYGLVLD SKTANLKEIFYSVKSLAQYIFENRK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacgaactaatagatgagataaaagagctcatcataaagagcttaaatttagaggat atgaaaccaagcgatatcgacgagaacgcgccgctttttaacgaggggctaggtcttgat agcgtcgatgcgctcgagcttggccttgcggtacaaaaaagctacggtttggtacttgac tctaaaacggcaaatttaaaagagattttttacagcgtaaaaagcctcgcgcaatatatc tttgaaaacaggaaataa

DBGET integrated database retrieval system