Campylobacter showae: CSHOW_1643 Help Entry CSHOW_1643        CDS       T07015                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csho  Campylobacter showae Pathway csho01100   Metabolic pathways csho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSHOW_1643 (acpP)    00074 Mycolic acid biosynthesis     CSHOW_1643 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSHOW_1643 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF5805 Motif Other DBs NCBI-ProteinID:  QCD49547 LinkDB All DBs Position complement(1675162..1675395) Genome browser AA seq 77 aa AA seqDB search MAIFDDVRDVVVEQLSVAPDAVKLESKIIEDLGADSLDVVELVMALEEKFEVEIPDSDAE KLITINDVVTYIENLNK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaatatttgatgacgtaagagacgtagtggtcgagcaactaagcgtggctccagat gcggtaaagcttgagtctaagattatcgaggatctaggtgcagactcgcttgacgtagtc gagctagttatggctcttgaggagaaatttgaagtagagatacctgatagcgacgccgag aaactaatcactataaacgacgtcgtaacctacatcgagaacctaaataaataa

DBGET integrated database retrieval system