Cronobacter malonaticus CMCC45402: P262_01038 Help Entry P262_01038        CDS       T02955                                  Name (GenBank) hypothetical protein   KO K02437   glycine cleavage system H protein Organism csi  Cronobacter malonaticus CMCC45402 Pathway csi00260   Glycine, serine and threonine metabolism csi00630   Glyoxylate and dicarboxylate metabolism csi00670   One carbon pool by folate csi00785   Lipoic acid metabolism csi01100   Metabolic pathways csi01110   Biosynthesis of secondary metabolites csi01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:csi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     P262_01038   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     P262_01038   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     P262_01038    00670 One carbon pool by folate     P262_01038 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GCV_H Biotin_lipoyl RnfC_N Motif Other DBs NCBI-ProteinID:  AHB69099 UniProt:  V5TX39 LinkDB All DBs Position 765408..765797 Genome browser AA seq 129 aa AA seqDB search MSNVPNELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPDVGTTVNAGDDCAV AESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYGQGWIFKIKASDEAEVAALLDAS AYEALLEDE NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagcaatgtgccaaacgaactgaaatacagcaaagaacacgaatggctgcgtaaagaa gctgacggcacttacaccgtcgggatcaccgagcacgcgcaggaactgctgggcgacatg gtgtttgtcgatctgccggacgtcggcacgaccgttaacgcgggcgatgactgcgccgtc gcggagtccgtaaaagccgcctccgacatctacgcgccggtcagcggcgagatcgtggcc gtcaacgacgcgctgagcgattcaccggagctggttaacagcgagccttacggccagggc tggatcttcaaaatcaaagccagcgatgaggccgaagtggctgcgctgctggacgccagc gcgtatgaagcgctgttagaagacgagtaa

DBGET integrated database retrieval system