Cronobacter malonaticus CMCC45402: P262_02173 Help Entry P262_02173        CDS       T02955                                  Name (GenBank) hypothetical protein   KO K02408   flagellar hook-basal body complex protein FliE Organism csi  Cronobacter malonaticus CMCC45402 Pathway csi02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:csi00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     P262_02173  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:csi02035]     P262_02173 Bacterial motility proteins [BR:csi02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     P262_02173 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FliE Gp138_C Motif Other DBs NCBI-ProteinID:  AHB69907 UniProt:  V5TY99 LinkDB All DBs Position 1613946..1614257 Genome browser AA seq 103 aa AA seqDB search MAIQGIEGVLQQMQATMQVARNNAVETPPSVSFAGELQAALGRISDTQNAARTQAEKFAI GTPGVALNDVMVDLQKSSISLQMGIQVRNKLVAAYQDIMNMQV NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctattcagggtattgaaggggtactccagcagatgcaggccaccatgcaggtggcg cgcaataatgctgttgagacgccgccctccgtgagtttcgccggagagttacaggccgcg cttggacgtatcagcgatacgcaaaacgccgcccgcactcaggcggaaaaattcgcaatc ggcacgccgggcgtggcgctgaacgatgtgatggtcgacctgcaaaaatcgtctatctcg ctgcagatgggcatccaggtgcgcaataagctggttgcggcgtaccaggacattatgaat atgcaggtgtag

DBGET integrated database retrieval system