Cronobacter malonaticus CMCC45402: P262_02751 Help Entry P262_02751        CDS       T02955                                  Name (GenBank) primosomal protein 1   KO K02317   DNA replication protein DnaT Organism csi  Cronobacter malonaticus CMCC45402 Pathway csi03440   Homologous recombination Brite KEGG Orthology (KO) [BR:csi00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     P262_02751  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:csi03400]     P262_02751 DNA repair and recombination proteins [BR:csi03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     RecBC pathway proteins      P262_02751 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DnaT ZnuA Motif Other DBs NCBI-ProteinID:  AHB70320 UniProt:  V5U023 LinkDB All DBs Position 2024121..2024405 Genome browser AA seq 94 aa AA seqDB search MGKFAISPDWKPDPDFRKQAAIWGIPLTKEVTPQELASFIDFWQAEGKAFHHTQWQQKLA RSVQQSRNRVNGRAGRDVNAIPEPEDEIPPGFRG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgggtaaattcgcgatatcgccggactggaagccagaccccgatttcaggaagcaggcc gcgatatggggcatcccgctgacgaaagaggtaaccccacaggagctggcatcgttcatc gacttctggcaggcagaggggaaggcatttcaccacacccaatggcagcagaagctggcg cgcagcgtgcagcagagccgaaacagagttaacggcagggccgggcgagacgtcaacgcg ataccagagccagaagacgagatccctccaggcttcagggggtga

DBGET integrated database retrieval system