Cronobacter malonaticus CMCC45402: P262_03458 Help Entry P262_03458        CDS       T02955                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism csi  Cronobacter malonaticus CMCC45402 Pathway csi01100   Metabolic pathways csi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P262_03458    00074 Mycolic acid biosynthesis     P262_03458   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P262_03458 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AHB70831 UniProt:  V5TZX8 LinkDB All DBs Position complement(2559456..2559692) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system