Cronobacter malonaticus CMCC45402: P262_03506 Help Entry P262_03506        CDS       T02955                                  Name (GenBank) hypothetical protein   KO K12149   DNA-damage-inducible protein I Organism csi  Cronobacter malonaticus CMCC45402 Brite KEGG Orthology (KO) [BR:csi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:csi03400]     P262_03506 DNA repair and recombination proteins [BR:csi03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     P262_03506 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI KH_PARP14_2 Motif Other DBs NCBI-ProteinID:  AHB70867 UniProt:  V5U127 LinkDB All DBs Position 2592760..2593005 Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTTPLPPGAIDALACELSRRIESHFPEMPNHVSVRYAAANQLSVLGGAKEDK DRISEILQETWESADDWFTTD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaagtgactatcgccaaaaccacgccgctaccgccgggcgctatcgacgcg ctggcctgcgagctatcccgccgtattgaaagccattttccggaaatgccgaatcatgtg agcgtgcgttatgccgccgctaaccaactgtcggttctgggtggcgcgaaagaagataaa gatcgcatcagcgaaattctccaggaaacctgggagagcgctgacgactggtttaccact gattaa

DBGET integrated database retrieval system