KEGG   Cronobacter malonaticus CMCC45402: P262_03911
Entry
P262_03911        CDS       T02955                                 
Name
(GenBank) gpmA protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
csi  Cronobacter malonaticus CMCC45402
Pathway
csi00010  Glycolysis / Gluconeogenesis
csi00260  Glycine, serine and threonine metabolism
csi00680  Methane metabolism
csi01100  Metabolic pathways
csi01110  Biosynthesis of secondary metabolites
csi01120  Microbial metabolism in diverse environments
csi01200  Carbon metabolism
csi01230  Biosynthesis of amino acids
Module
csi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csi_M00002  Glycolysis, core module involving three-carbon compounds
csi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P262_03911
  09102 Energy metabolism
   00680 Methane metabolism
    P262_03911
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P262_03911
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csi04131]
    P262_03911
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csi04147]
    P262_03911
Enzymes [BR:csi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     P262_03911
Membrane trafficking [BR:csi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    P262_03911
Exosome [BR:csi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   P262_03911
  Exosomal proteins of melanoma cells
   P262_03911
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: AHB71155
UniProt: V5U2D9
LinkDB
Position
2922148..2922900
AA seq 250 aa
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGYSFDFAYTSVL
KRAIHTLWNILDGLDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPALTKDDERFPGHDPRYAKLSEQELPLTESLALTIDRVIPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt   +upstreamnt  +downstreamnt
atggctgttactaagctggttctggttcgtcacggtgaaagccagtggaacaacgaaaac
cgctttaccggttggtatgacgttgacctgtctgaaaaaggcgtcagcgaagcgaaagct
gcgggcaagctgctgaaagacgaaggctacagctttgactttgcttatacctccgtgctg
aaacgtgccatccacacgctgtggaacatcctggacgggctggatcaggcctggctgccg
gttgaaaaatcctggaaactgaacgagcgtcactacggtgcgctgcagggtctgaacaaa
gccgaaaccgctgaaaaatacggtgatgagcaggtgaaacagtggcgtcgcggcttcgcg
gtgactccgccggcgctgaccaaagatgacgagcgtttcccgggccacgatccgcgttac
gcgaaactgagcgagcaggagctgccgctgaccgagagcctggcgctgaccatcgatcgc
gttattccttactggaatgaaaccattctgccgcgcctgaaaagcggtgagcgcgtgatt
atcgccgctcacggtaactccctgcgtgcgctggtgaaatacctggataacatgagcgaa
gaagagattcttgagctgaacatcccgaccggcgtaccgctggtgtatgagtttgacgag
aacttcaaaccgattaaacactactatctgggcaatgctgacgagatcgcagcgaaagcg
gcggctgtcgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system