Cronobacter malonaticus CMCC45402: P262_03932 Help Entry P262_03932        CDS       T02955                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism csi  Cronobacter malonaticus CMCC45402 Pathway csi00190   Oxidative phosphorylation csi01100   Metabolic pathways csi02020   Two-component system Module csi_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:csi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     P262_03932  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     P262_03932 Enzymes [BR:csi01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      P262_03932 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AHB71169 UniProt:  V5U300 LinkDB All DBs Position complement(2935187..2935300) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEHVEATKAGKVES NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggattctcggaacgcttctggcctgtgctttcggaatcattacc gcgctggcgctggaacacgtcgaagcgaccaaagccggtaaagtcgagtcgtga

DBGET integrated database retrieval system