Cronobacter malonaticus CMCC45402: P262_04044 Help Entry P262_04044        CDS       T02955                                  Name (GenBank) tatE protein   KO K03425   sec-independent protein translocase protein TatE Organism csi  Cronobacter malonaticus CMCC45402 Pathway csi03060   Protein export csi03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:csi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     P262_04044  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     P262_04044  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:csi02044]     P262_04044 Secretion system [BR:csi02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    P262_04044 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AHB71244 UniProt:  V5U364 LinkDB All DBs Position complement(3022691..3022894) Genome browser AA seq 67 aa AA seqDB search MGEISITKLLVIAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMNDDEAGAKTPAASEAPA ERLSHKE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgggtgaaattagtattaccaaactgctcgtgatcgccgcactggttgttctgctgttt ggtaccaaaaaactgcgtacgcttgggggagacctgggcgctgcgattaaaggcttcaaa aaagcgatgaatgacgacgaagctggcgcgaaaacgcctgcggcgtccgaagcgccggca gaacgcctttctcataaagaataa

DBGET integrated database retrieval system