Camellia sinensis (tea plant): 114260302 Help Entry 114260302         CDS       T07364                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism csin  Camellia sinensis (tea plant) Pathway csin03083   Polycomb repressive complex csin04120   Ubiquitin mediated proteolysis csin04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csin00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114260302    04120 Ubiquitin mediated proteolysis     114260302   09126 Chromosome    03083 Polycomb repressive complex     114260302  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csin04131]     114260302    04121 Ubiquitin system [BR:csin04121]     114260302    03036 Chromosome and associated proteins [BR:csin03036]     114260302 Membrane trafficking [BR:csin04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     114260302 Ubiquitin system [BR:csin04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      114260302    Cul7 complex      114260302 Chromosome and associated proteins [BR:csin03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      114260302   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      114260302 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  114260302 NCBI-ProteinID:  XP_028056184 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSTSKTIVLKSSDGETFEVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC KKHVDTPKSDDKTAEDELKNFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFSPEEEEEVRRENAWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgacttcgaagacaatcgtgttgaaaagctccgatggcgagacctttgaggttgag gaatcggtggcgttggagtcgcagaccatcaagcacatgatcgaggacgattgcgccgat accagcattcctctccccaacgtcactagcaagatcttggccaaggtcatcgagtactgc aaaaagcatgtcgatactcccaagtccgatgacaagactgcagaggatgaactcaagaac tttgatgccgagttcgtcaaagtcgatcagggcactctcttcgatctcatcctggcagca aattatctgaacatcaagagcctgctggatttgacatgtcagacagtggcagacatgatc aagggaaagactccagaggagatccgcaagacatttaacatcaagaatgacttctctcca gaggaagaggaagaggttcgcagggagaatgcttgggcattcgagtga

DBGET integrated database retrieval system