KEGG   Camellia sinensis (tea plant): 114273830
Entry
114273830         CDS       T07364                                 
Name
(RefSeq) monoterpene synthase-like
  KO
K21926  (+)-alpha-terpineol/(4S)-limonene synthase [EC:4.2.3.112 4.2.3.16]
Organism
csin  Camellia sinensis (tea plant)
Pathway
csin00902  Monoterpenoid biosynthesis
csin01100  Metabolic pathways
csin01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csin00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    114273830
Enzymes [BR:csin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.16  (4S)-limonene synthase
     114273830
    4.2.3.112  (+)-alpha-terpineol synthase
     114273830
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 DUF6793
Other DBs
NCBI-GeneID: 114273830
NCBI-ProteinID: XP_028071448
LinkDB
Position
Unknown
AA seq 583 aa
MALRALFSPFLVSPILLASLQSPKTPTTVCPSKSIRCASNTITIDDHTVTRRSANYPPSF
WDYNFVQSLSSDYTEEKYMREAYNMKDEVKGLINGVMDPLAKLELIDAVQRLGLKYHFEG
EIKQSLDDLIHLHNDAWCSDDLHATALRFRLLRQHGCDVPKDVFESFKDETGNFKISLFE
DVKGLLSLYEASFFGLDGETIIDEAKIFTIANLKNIKGDMSPSMVRKVGHALDMPLHWRL
TRVEARWFIETYEQEQNMSPILLEFAKLDYNMVQSVHQKEVGNLARWWVDMGLDKMSFAR
DRLVEHYLWCSGMVFEPKFGAFRDMGTKIISLITTIDDIYDVYGALHEIELFTDFVDSQK
IITSIPHNIRTCLLALFNTVNEIGYWTLKNRGFNIIPYLSKAWADVLKACLKEAKWYHSG
YKPTLGEYLDNAVVSIGAPLALFTSYFLTTENINEEALHYIDKLPSIMRCSSMLVRLTND
LGTSSDELARGDNLKAVQCYMNETGASEEVARDYINNLVHETWKTMNKGMFESYPFSEPF
LSANPNLGRTAQCFYQYGDGHGIPHNWTKDHLISLLVQPIPLK
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcccttcgagctctattttcaccatttcttgtctctccaattctcctagcctctctt
caatcacccaaaacccctaccaccgtttgtccttctaaatccattcgatgtgcgagcaat
accataacgattgatgatcatacagttactcgacgatcagcaaattatccaccaagtttt
tgggactacaattttgtgcagtcacttagcagcgattacaccgaggagaaatatatgagg
gaggcttataatatgaaggatgaagtgaaaggtctcataaatggagtgatggacccgttg
gcaaagctggagttgatcgatgccgttcaaaggctaggattaaagtatcattttgagggt
gagattaagcaatcgcttgatgatttgatacacttacacaacgacgcatggtgttctgat
gatctgcatgcaacagccctccgatttaggcttcttagacagcacggatgtgatgtaccc
aaagatgtgttcgaaagcttcaaggatgagaccggtaatttcaagatatccctctttgag
gatgtgaaagggctgctgagtttgtatgaagcttctttcttcgggttggacggtgaaact
atcattgatgaagccaagatcttcacaattgcaaatttgaagaatatcaaaggagacatg
tcaccgagtatggttagaaaagttggccatgctttggatatgcccttgcattggaggcta
acaagggttgaggctagatggttcatagagacatatgagcaagaacaaaatatgagccct
attttgcttgaatttgctaaattggactacaacatggtgcagtctgttcatcaaaaggag
gttggcaatttggcaaggtggtgggtggacatgggcttagacaaaatgagctttgcgaga
gacaggttggtggaacactacctttggtgctctggaatggtgtttgagccaaaatttgga
gcttttagagacatggggactaagattattagtttaataacaacaatcgatgacatttat
gatgtctatggtgcactgcatgaaatagagctcttcacggactttgttgacagtcaaaaa
atcattacaagcattccacacaatataaggacatgcctgcttgctctattcaataccgtc
aatgaaatagggtattggacactgaaaaaccgaggcttcaacatcattccttatttgagc
aaagcgtgggctgacgtgttgaaagcatgtctaaaagaggcaaaatggtatcatagtggg
tacaagccaacattgggggagtatcttgacaatgcagtggtttccataggagcacctctc
gcgctcttcacaagttatttcttaaccactgaaaatattaatgaggaggctttacattac
atagacaagctacccagtatcatgcgttgctcctctatgcttgttcgactcactaatgat
ttgggaacctcctcggatgaattggcaagaggagataatctcaaggcagtccagtgctac
atgaatgaaactggagcttctgaagaagttgctcgagattacataaacaatttggttcat
gagacatggaagactatgaacaaaggcatgtttgaaagctatcccttctctgaaccattt
ttgagtgctaatccaaatcttggccgaacagctcaatgcttttaccagtatggagatggg
catggcattccacacaactggaccaaggaccatctcatttcattattggtccaacccatt
cctctcaagtaa

DBGET integrated database retrieval system