Camellia sinensis (tea plant): 114279956 Help Entry 114279956         CDS       T07364                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism csin  Camellia sinensis (tea plant) Pathway csin03083   Polycomb repressive complex csin04120   Ubiquitin mediated proteolysis csin04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csin00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114279956    04120 Ubiquitin mediated proteolysis     114279956   09126 Chromosome    03083 Polycomb repressive complex     114279956  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csin04131]     114279956    04121 Ubiquitin system [BR:csin04121]     114279956    03036 Chromosome and associated proteins [BR:csin03036]     114279956 Membrane trafficking [BR:csin04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     114279956 Ubiquitin system [BR:csin04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      114279956    Cul7 complex      114279956 Chromosome and associated proteins [BR:csin03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      114279956   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      114279956 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Nup84_Nup100 Motif Other DBs NCBI-GeneID:  114279956 NCBI-ProteinID:  XP_028078041 LinkDB All DBs Position Unknown AA seq 157 aa AA seqDB search MSSTRKIILKSSDGETFEVDEVVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC KKHVETPKSEDRATGVEDELKTFDIEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVAD MIKGKTPEEIRKTFNIQNDFTPEEEEEVRRENQWAFE NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcaacgaggaagatcatcctgaagagctcggacggtgagaccttcgaggtcgac gaggtggtggctctggagtcgcagacgattaagcacatgatcgaggacgattgcgccgat aacggaattccattgccgaacgtgacgagcaagatcttatcgaaggtgatcgagtactgc aagaagcacgtcgagactccaaaatccgaagatcgcgccaccggcgtcgaggacgaactc aagactttcgatatcgaattcgtcaaagtcgaccagggcactctgtttgatctcattctg gcagcaaactatctgaatatcaagagcttgttggatctgacctgccagactgttgcagac atgatcaagggaaaaactccagaagaaatccgcaaaacatttaacattcagaatgacttc accccagaggaggaggaggaggtccgcagggagaaccaatgggccttcgaatga

DBGET integrated database retrieval system