Camellia sinensis (tea plant): 114281101 Help Entry 114281101         CDS       T07364                                  Name (RefSeq) calmodulin-2/4-like   KO K02183   calmodulin Organism csin  Camellia sinensis (tea plant) Pathway csin04016   MAPK signaling pathway - plant csin04070   Phosphatidylinositol signaling system csin04075   Plant hormone signal transduction csin04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:csin00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     114281101    04070 Phosphatidylinositol signaling system     114281101    04075 Plant hormone signal transduction     114281101  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     114281101  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csin01009]     114281101   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csin04131]     114281101    03036 Chromosome and associated proteins [BR:csin03036]     114281101   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csin04147]     114281101 Protein phosphatases and associated proteins [BR:csin01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114281101 Membrane trafficking [BR:csin04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114281101 Chromosome and associated proteins [BR:csin03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114281101 Exosome [BR:csin04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114281101 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C FCaBP_EF-hand UPF0154 PA_Ig-like DUF6279 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  114281101 NCBI-ProteinID:  XP_028079347 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MQSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEERKEAFRVFDKN QNGFISAAELRHVMTNLGEKLTDEEVDEMERYV NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcagtctttgggacagaacccaacagaagctgagcttcaggacatgatcaatgaggtt gatgctgatggaaatgggacaattgatttcccagagttcctcaacctgatggcccggaag atgaaggatactgactctgaggaggagcgtaaggaagctttccgggtttttgacaagaac cagaatggcttcatttctgctgctgagctccgccatgttatgacaaatcttggtgagaag ctcacagatgaggaagtggacgagatggaaaggtatgtgtag

DBGET integrated database retrieval system