Camellia sinensis (tea plant): 114294051 Help Entry 114294051         CDS       T07364                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism csin  Camellia sinensis (tea plant) Pathway csin03083   Polycomb repressive complex csin04120   Ubiquitin mediated proteolysis csin04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csin00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114294051    04120 Ubiquitin mediated proteolysis     114294051   09126 Chromosome    03083 Polycomb repressive complex     114294051  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csin04131]     114294051    04121 Ubiquitin system [BR:csin04121]     114294051    03036 Chromosome and associated proteins [BR:csin03036]     114294051 Membrane trafficking [BR:csin04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     114294051 Ubiquitin system [BR:csin04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      114294051    Cul7 complex      114294051 Chromosome and associated proteins [BR:csin03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      114294051   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      114294051 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Methyltransf_16 Motif Other DBs NCBI-GeneID:  114294051 NCBI-ProteinID:  XP_028093952 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSSSKKITLKSSDGEAFEVEESLALESQTIKHMIEDDCAHSVIPLPNVTSKILAKVIEYC KKHVQISKTQDRSAEDELKTWDSDFVKVDQPTLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFSADEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgtcgaagaagatcacgctgaagagctccgacggagaggcgttcgaagtggag gagtcgttggcgctggaatcgcagacgatcaagcacatgatcgaggacgattgcgcccac agcgtcattcctctccccaacgtcaccagcaagatcctcgctaaggtcatcgagtactgc aaaaagcacgtccagatctccaagacccaagatcgatctgccgaggacgagctcaagacc tgggactctgacttcgtcaaagtcgatcagcccactctcttcgacctcattctggctgca aactacttgaacataaagagcctgctggatctaacatgccagacagttgcggacatgata aaaggaaagactccggaggaaatccggaagaccttcaacataaagaatgacttcagtgct gatgaagaagaagaggttcgtagagagaaccagtgggcctttgagtaa

DBGET integrated database retrieval system