Camellia sinensis (tea plant): 114311386 Help Entry 114311386         CDS       T07364                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism csin  Camellia sinensis (tea plant) Pathway csin04145   Phagosome csin04148   Efferocytosis csin04620   Toll-like receptor signaling pathway csin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:csin00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     114311386    04148 Efferocytosis     114311386  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114311386  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     114311386  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csin04131]     114311386   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csin04147]     114311386    04031 GTP-binding proteins [BR:csin04031]     114311386 Membrane trafficking [BR:csin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     114311386  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     114311386   Macropinocytosis    Ras GTPases     114311386  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     114311386 Exosome [BR:csin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114311386   Exosomal proteins of other body fluids (saliva and urine)    114311386   Exosomal proteins of colorectal cancer cells    114311386   Exosomal proteins of bladder cancer cells    114311386 GTP-binding proteins [BR:csin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     114311386 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  114311386 NCBI-ProteinID:  XP_028113330 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENISKKWIPELRHYAPGIPVVLVGTKL DLREDKQFFVDHPGAVPITTAQGEELKKLIGAAAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKKRGQKNCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcgaggttcatcaagtgcgtcaccgttggcgatggagctgttggcaagact tgtatgcttatctcctataccagcaacacctttcccactgattatgtgccgactgttttt gacaattttagtgcaaacgtggttgtggatgggagcactgttaatttaggactttgggat acagcaggtcaggaggattacaatagattaagacccctgagctatcgaggggctgatgtc tttatacttgcattttctctgattagcaaggctagctatgaaaatatatcaaaaaagtgg attcctgaattgaggcattatgctcctggaattccagtagttcttgttggaacaaagctt gatcttcgagaagataagcagttctttgtagaccaccctggtgctgtgcccattacaaca gctcagggagaggagctgaaaaagctgattggagctgctgcttacattgaatgcagttca aaaacccagcagaatgtgaaggctgtttttgatgcggccattaaggtggttctccaacca ccaaagcagaagaagaaaaagaagaaaaggggacaaaaaaattgcagtatcttgtaa

DBGET integrated database retrieval system