Camellia sinensis (tea plant): 114312272 Help Entry 114312272         CDS       T07364                                  Name (RefSeq) GTP-binding protein SAR1A-like   KO K07953   GTP-binding protein SAR1 [EC:3.6.5.-] Organism csin  Camellia sinensis (tea plant) Pathway csin04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:csin00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114312272  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csin04131]     114312272   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:csin04031]     114312272 Membrane trafficking [BR:csin04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Coat protein complex II (COP-II)     114312272 GTP-binding proteins [BR:csin04031]  Small (monomeric) G-proteins   Arf/Sar Family    Sar     114312272 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Motif Other DBs NCBI-GeneID:  114312272 NCBI-ProteinID:  XP_028114292 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MQVDSVVYLVDAYDKERFAEAKKELDALLSDDSLANVPFLILGNKIDIPYVASEDELRYY LGLTGVTTGKGNVDLADSNVRPIEVFMCSIVRKMGYGDGFKWLSQYIK NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgcaagtggattctgtagtttaccttgttgatgcatacgacaaagagagatttgcagag gccaaaaaggagctggatgccctcctttcagacgattcacttgcaaatgtcccgtttctc atacttgggaacaagattgacataccctatgttgcctcagaggatgagttgagatattac ttgggtttgactggtgttactaccggtaagggtaatgttgacctcgctgactcaaatgtc cgtcctattgaggtcttcatgtgcagtatcgtgcgcaagatgggatatggtgatggcttt aagtggctttcccaatacattaagtag

DBGET integrated database retrieval system