Camellia sinensis (tea plant): 114321349 Help Entry 114321349         CDS       T07364                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism csin  Camellia sinensis (tea plant) Pathway csin03010   Ribosome csin04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:csin00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     114321349   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114321349  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:csin03011]     114321349    04121 Ubiquitin system [BR:csin04121]     114321349 Ribosome [BR:csin03011]  Ribosomal proteins   Eukaryotes    Large subunit     114321349   Archaea     114321349 Ubiquitin system [BR:csin04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    114321349 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD UBL_UBAC1 Plexin_RBD DUF2604 Ubiquitin_5 Dsc3_N OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  114321349 NCBI-ProteinID:  XP_028124311 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN IQKESTLHLVLRLRGGF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgttaagactcttaccggaaagacgatcactctcgaagtcgagagctct gacaccatcgacaacgtcaaggccaagatccaggacaaggaaggcattccaccggaccaa cagcgtctcatcttcgccggaaaacagcttgaagatggccggaccttggccgattacaat attcagaaggagtcgactcttcaccttgtgctgcgtctccgtggtggtttttga

DBGET integrated database retrieval system