Camellia sinensis (tea plant): 14412439 Help Entry 14412439          CDS       T07364                                  Symbol psbF, CSC0662 Name (RefSeq) photosystem II protein VI   KO K02708   photosystem II cytochrome b559 subunit beta Organism csin  Camellia sinensis (tea plant) Pathway csin00195   Photosynthesis csin01100   Metabolic pathways Module csin_M00161   Photosystem II csin_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:csin00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     14412439 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:csin00194]     14412439 (psbF) Photosynthesis proteins [BR:csin00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     14412439 (psbF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-GeneID:  14412439 NCBI-ProteinID:  YP_007317264 UniProt:  L0E5Z4 LinkDB All DBs AA seq 39 aa AA seqDB search MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgaccatagatcgaacctatccaatttttacagtgcgatggttggctgttcacggacta gctgtacctaccgtttcttttttggggtcaatatcagcaatgcagttcatccaacgataa

DBGET integrated database retrieval system