Camellia sinensis (tea plant): 40867546 Help Entry 40867546          CDS       T07364                                  Symbol nad4l, FPH45_mgp16 Name (RefSeq) NADH dehydrogenase subunit 4l   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism csin  Camellia sinensis (tea plant) Pathway csin00190   Oxidative phosphorylation csin01100   Metabolic pathways Module csin_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:csin00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     40867546 (nad4l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:csin03029]     40867546 (nad4l) Enzymes [BR:csin01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      40867546 (nad4l) Mitochondrial biogenesis [BR:csin03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     40867546 (nad4l) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 DUF1899 Motif Other DBs NCBI-GeneID:  40867546 NCBI-ProteinID:  YP_009676240 UniProt:  A0A4Y5WYQ4 LinkDB All DBs AA seq 90 aa AA seqDB search MIISISGIRGILLNRRNIPIMSMPIESMLLAVNSNFLVFSVSSDDMMGQSFASLVPTVAA AESAIGSAIFVITFRVRGTIAVESINSIQG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgatcatctctatttcaggtattcggggaatcctccttaatagacgaaatattcctatt atgtcaatgccaattgaatcaatgttattagctgtgaattcgaactttttggtattttcc gtttcttcggatgatatgatgggccaatcatttgcttcattggttccaacggtggcagct gcggaatctgctattgggtcagccattttcgttattactttccgagtccgagggactatt gctgtagaatctattaatagcattcaaggttaa

DBGET integrated database retrieval system