Cronobacter sakazakii ATCC 29544: CSK29544_03906 Help Entry CSK29544_03906    CDS       T03903                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism csj  Cronobacter sakazakii ATCC 29544 Pathway csj00190   Oxidative phosphorylation csj01100   Metabolic pathways csj02020   Two-component system Module csj_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:csj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CSK29544_03906  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     CSK29544_03906 Enzymes [BR:csj01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      CSK29544_03906 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AKE96851 UniProt:  A0A2S9UEW0 LinkDB All DBs Position complement(4035046..4035159) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEHVEATKAGKVES NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggattctcggaacgcttctggcctgtgctttcgggatcattacc gcgctggcgctggaacatgtcgaagcgaccaaagccggtaaagtcgagtcgtga

DBGET integrated database retrieval system